PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family BBR-BPC
Protein Properties Length: 280aa    MW: 31177.7 Da    PI: 10.1798
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005817genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind334.72.4e-10212801301
  GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdnkllalllv 87 
                mddd+ + rn+gyyep+  +k +lglqlmssi+erd k     r+  + + + ++++++rd         m++  rd++  +        ++++l++l++
  Cla005817   1 MDDDALNMRNWGYYEPS--FKGHLGLQLMSSISERDMKHflpgRDPSV-MVNANGSFHPRDcvvseapvhMNY-VRDNWGGN-------PRDRFLNMLPA 89 
                9***9999*******99..*******************99*9999999.9***********888888888888.78888777.......56789*****9 PP

  GAGA_bind  88 enslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaders 187
                +++        + v+++t+ ++slq      l++++     ++++ a  +ee + +++  k kk+++++  pk++kakk++k      k+++++   +r+
  Cla005817  90 NHN--------YPVIPETSGAHSLQI-----LQPPSSS---RDEIAASRVEEPPVKKEGGKAKKRQNSEGGPKTPKAKKPRK-----PKDTSMAV--QRV 166
                997........889********9999.....4444444...33344445555444444444444455556677777777777.....12344555..689 PP

  GAGA_bind 188 kaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkd 287
                k +kk+idlv+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt+iS+yPLP+s krrgaRiagrKmSqgafkk+LekLaa+Gy+++np+DL++
  Cla005817 167 KPPKKNIDLVINGIDMDISSIPIPVCSCTGAPHQCYRWGCGGWQSACCTTNISTYPLPMSDKRRGARIAGRKMSQGAFKKVLEKLAADGYNFANPIDLRT 266
                **************************************************************************************************** PP

  GAGA_bind 288 hWAkHGtnkfvtir 301
                hWA+HGtnkfvtir
  Cla005817 267 HWARHGTNKFVTIR 280
                *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.2E-1671280IPR010409GAGA-binding transcriptional activator
PfamPF062171.7E-1111280IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDDDALNMRN WGYYEPSFKG HLGLQLMSSI SERDMKHFLP GRDPSVMVNA NGSFHPRDCV  60
VSEAPVHMNY VRDNWGGNPR DRFLNMLPAN HNYPVIPETS GAHSLQILQP PSSSRDEIAA  120
SRVEEPPVKK EGGKAKKRQN SEGGPKTPKA KKPRKPKDTS MAVQRVKPPK KNIDLVINGI  180
DMDISSIPIP VCSCTGAPHQ CYRWGCGGWQ SACCTTNIST YPLPMSDKRR GARIAGRKMS  240
QGAFKKVLEK LAADGYNFAN PIDLRTHWAR HGTNKFVTIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654525.10.0PREDICTED: protein BASIC PENTACYSTEINE2
SwissprotQ9SKD01e-111BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A0A0KJH70.0A0A0A0KJH7_CUCSA; Uncharacterized protein
STRINGVIT_01s0011g06380.t011e-145(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-108basic pentacysteine 2